SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000321249|PACid:22623769 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000321249|PACid:22623769
Domain Number 1 Region: 461-671
Classification Level Classification E-value
Superfamily Cullin homology domain 1.19e-46
Family Cullin homology domain 0.0022
Further Details:      
 
Domain Number 2 Region: 1038-1100,1168-1250
Classification Level Classification E-value
Superfamily SET domain 6.02e-27
Family Viral histone H3 Lysine 27 Methyltransferase 0.097
Further Details:      
 
Domain Number 3 Region: 709-774
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 4.9e-18
Family SCF ubiquitin ligase complex WHB domain 0.009
Further Details:      
 
Domain Number 4 Region: 867-983
Classification Level Classification E-value
Superfamily TPR-like 0.00000000000000548
Family Tetratricopeptide repeat (TPR) 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000321249|PACid:22623769
Sequence length 1390
Sequence
MADSISSVCNLAVLDKLSXXSINEILESYSGFCAATDTLLTGAGDLSAGQQIVSHVHGLC
KHGLESLLRDYFLGALERTFEKNGALKFWRHFEAYDGDGSIEEEVFYNALEEIAMEKQYQ
EKCLLILVHALQSYNQGSHDSDDYRAQLFAKYQLSVSSVLMATLPRHFPEVLHWYFKGRL
EELSTIMGGEFPRDHDEDDGADDMDVDDKCKVSYRSGQMEIDECYPQGRFLDNNKLVNNI
GKVVRDLRSLGFTSMAEDAYASAIFLFLKAKVHDLAGDDYRVSFLESIKRWIQAVPLQFL
HALLAYLGDTVSYDSASSGFKSPLASCPNTFYPGIDIPSEGLVRWQLRLEYFAYETLQDL
RIAKLFEIIVDYPDSSPAXEDLKQCLEYTGQHSKLVESFITALRYRLLTADGTGGNSNVS
GNTGDSLLEELNRDEENQENTGLDDDFHTDDKQAWINALRWEPDPVEADPLKGSRNRRKV
DILGMIVGIIGSKDQLVNEYRVMLAEKLLNKSDYDIDTEIRTLELLKASTDLGDKGVSMD
NFDATIISSNFWPQIQDESLNVPGPVDQLLSDYAKRFNEIKTPRKLLWKKSLGTVKLELQ
FDXRAVQFMVAPIQAAIIMQFQDQTSWTSKDLAAAIGVPVDILNRRINFWISKGILAESP
GADSEDHMFTLMEGMVDTGKNGGNNGSIEDLVVGDEEGESSVASVEDQLXKEMTVYEKFI
LGMLTNFGSMALDRIHNTLKMFCIADPPYDKTLQQLQSFLSGLVSEEKLELRDGMXIESS
TLGSSCERFISMHSEIYXIESIHSISVIISTTSFCFIYWPYLTXSSRSTYPFNGTETLXN
PNRIENXEMREETEQQDQLAMAAAEEQLQQLRSKATELXLREEWQESVQAYSHFIXLCRS
HISNTLQNPDPDHLPKLRKSLCLALSNRAEARSRLRDFAEALRDCDRALEIXRAHFKTLV
CKGKILLNLNRYSMALXCFRTAQLDPQANGSSVDLDGYLQKSKKLELMSRTGAFDLSEWV
VNGFRGKPLEPAEYIGAVQIKKSEIRGRGLFATKNIDVGTLMLVTKAVAIERGILPGQEL
DENAQLLMWKNFTEKVMDSMAKXSRIRDLISTLSSGEDEDELEVPEIXXFKPEAEHNGGC
HNENELDASRILSILDVNSLVEGGISXKILGKNSDYYGVGLWVLASFINHSCVPNARRMH
IGDXVMVHASRDVKAGEEITFAYFDVLSPLXKRNESCKTWGFRCNCKRCKFEKKLYSRED
VREIEMGLERRMEAGAAVYKLEEGMRRWIVKEREKGYLRASFWDACSQVYGTEKSAKGWG
RRIPPMETXVDSVVQAVGSDERVLRMVAEKLKRGGGGMLEMERALKLGRGVYGKVVKKQA
XKSLVGLGIP
Download sequence
Identical sequences MDP0000321249|PACid:22623769 MDP0000321249

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]