SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000373054|PACid:22683333 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000373054|PACid:22683333
Domain Number 1 Region: 26-182
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.0000000000434
Family FAD-linked reductases, N-terminal domain 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000373054|PACid:22683333
Sequence length 266
Sequence
MCKEGRLTLRFEDVTTGQRSRAEGEGRRVHVIERDLSEPDRIVGELLQPGGYLKLIELGL
EGKQLLKITANESIDAQKVFGYALYKNGNDTKLSYRLKNYASDIVRRSFHNGRFIHKMHE
RGATHKNVTLEQGTVTALIEEKGTIKGVTYKNKAGEEMRSYVPLTIVCDGCFSYLRRNLC
SPKVDNPSCFVGLILENCDLPYANHGHVILGEPSPILFYPISSTEVRCLVDVPGTKVPSL
ANGEMAKYLKTVVAPQVSIINMNNNG
Download sequence
Identical sequences MDP0000373054 MDP0000373054|PACid:22683333

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]