SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000374867|PACid:22644271 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  MDP0000374867|PACid:22644271
Domain Number - Region: 155-187
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.00777
Family GDI-like N domain 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000374867|PACid:22644271
Sequence length 211
Sequence
MAFPSSSQVDPKMLDPSLNQSDLLGLPGLPGLPGLPGLPGLPGLPGLPGLPGLPGLPGLP
GLPGLPLAAEKTSSESSNSKTSKNGQLGDNKEVAHPDSLPADXLVSPTSSKFAISXSILS
SCDLPCKGRNLNGVFNPSPKAXNKLFNDDGPIKXTNFDLIVIGTGLPGSXXAAXXSXAXX
TVLXLDEWWDSHPLLLIPRWEQPAATVVDWV
Download sequence
Identical sequences MDP0000374867 MDP0000374867|PACid:22644271

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]