SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000449130|PACid:22621886 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000449130|PACid:22621886
Domain Number 1 Region: 485-770
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.56e-76
Family Protein kinases, catalytic subunit 0.0002
Further Details:      
 
Domain Number 2 Region: 72-167,199-230
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 1.7e-23
Family alpha-D-mannose-specific plant lectins 0.0054
Further Details:      
 
Weak hits

Sequence:  MDP0000449130|PACid:22621886
Domain Number - Region: 364-415
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.000259
Family Hairpin loop containing domain 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000449130|PACid:22621886
Sequence length 945
Sequence
MMNSSRNKLSYMSSVVVLVLCLNLKAAHVSTASGNIISQGQSISGNQTISSSPRGIFELG
FFTPGNSHNHYIGIWYKKLQKTVVWVANRNHPVSDPFSSSLQLFPNGTLILLDQSKSSIW
STXRDXSVXSNSTSEVAAXLLDNGNFVXTXALNSSAVIWQSFDHPTDTWXPGGKLGYNKL
TNEKLTLTPWRXSQNPAPGIFSLEIERNGTSFLLMYNGTKMYWTSGPWTGKIFKYVPEIQ
LNYLVTNISYKSDEFGSYVSYDAVFPDIFVRYMLDISGQFRAYKWGKDYNQWTSFWLRPS
EHCEVYGFCGASSICNQQQVPLCVCLEGFEPRAPKDWDLEDHTEGCVRKTXLECSXGSGG
NDTFVVIPDLRFPENPETLAGKNIDECRSACLSDCXCTAFAYDSGCLVWKGDLFNVKQLX
SDETVGXELXLRVAASEEPKXKRENKTFWIVIGVLGGLCGVLLVIXVIAKNECSGSGERS
EADEGSLTMFKYRVLRNATKNFTEKLGEGGFGSVFRGTLKSYTAIAVKRLNCPKQADKQF
LTEVRTLGKVQHINLVRLRGFCAETSKRFLVYDYMPNGSLESLLFQKSPIVLNWKTRYHI
AVGTARGLAYLHHSCRECIIHCDIKPENILLDAEYAPKIADFGLAKLVSRDFSRVITTMQ
GTRGYIAPEWISGEAITXKADVFSYGMLCFEIISGRRNRDLLDDGLQNYFPTRVANVLTK
GEDVDTLLDCRLEGNANKEEVMRACKVACWCIQDDENDRPTMGQVVQLLEGVIDLGIPPI
PQFLDRFSKSLXESIHYHNISSSTASDSRRGXSSCNAYTSFVNLDQGLPVDRWPEPGMGL
QWASPRVPECGTQADCEGKSTYRFDPAVGVLVIDEQVDIEDEDDDAENNGDDDERKVEIN
PRGGGVLAALESNRRDGDGESEIRVRDVKFRVQVIADLYRWSEKE
Download sequence
Identical sequences MDP0000449130 MDP0000449130|PACid:22621886

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]