SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000501957|PACid:22671723 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000501957|PACid:22671723
Domain Number 1 Region: 53-225,319-429
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.36e-42
Family FAD-linked reductases, N-terminal domain 0.087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000501957|PACid:22671723
Sequence length 509
Sequence
MVYEYVLAGVLVSLLSSVFFVIINXTFSEKKKDDVANVSATGVFLAPEIEKSTDVVIVGA
GVAGAALAYTLGKEGXRVHVIERDLNEPDRIVGELLQPGGYLKLIELGLEDCANESIDAQ
KVFGYALYKNGNDTKLSYPLETYSSDIAGRSFHNGRFIQRMRGRASTLSNVKLEQGTVTX
LIEEKGTIKGVMYKNKAGEEMRTYAPLTIVCDGCFSNLRRSISTPNIENPSCFVGMILEN
CELPHANHGHVXLGDPSPILFYXISSTEVRCLVDVPGTKVPSVANGEMAQYLKTAVAPQV
PHQLLKAFLAAVDKGIIRTMQNKSMPAAPQPTPGAILLGDAFNMRHPLTGGGMTVALSDI
VLLRDLLRPLSDFNDAPALCDYLESFYTLRKPVSSTINTLAGALYKVFCASPNPARQEMR
EACFDYLSLGGICSNGPISLLSGLNPRPISLFLHFFAVAVYGVGRLMIPFPTPKRMWLGA
RLILVCYLFSQYCLISKLVTLVILRTIQT
Download sequence
Identical sequences MDP0000501957|PACid:22671723 MDP0000501957

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]