SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000534780|PACid:22663807 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000534780|PACid:22663807
Domain Number 1 Region: 167-262
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.94e-25
Family B3 DNA binding domain 0.00026
Further Details:      
 
Domain Number 2 Region: 42-98
Classification Level Classification E-value
Superfamily DNA-binding domain 0.00000000000000641
Family GCC-box binding domain 0.00084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000534780|PACid:22663807
Sequence length 396
Sequence
MEEGMSRTISNVGVKRDVEEVCDPNLAANDSSDGASRHVSKRFKGVVEQPNGHWGAQIYA
NHERVWLGTFSSENEAAMAYDSAAIKLRGWECHRNFPWTKVTFEEPHFQNQYSKEAVLRM
IKDXSYQAEFLEYRKSCAASKSLRSGIQFDSLVRVHSNGNAKMLNRLLFQKELTPSDVSK
LNRLVIPVTNAKRCFPSISESISQKVESGSSQLVFYDKMMRSWTFRYCYWKSSRSFVFTR
GWSRFVKTHHLKAKDILTFFQCHYKQLGDNGNEEPQTFYMVKVNWDGAESEDDNINCLVE
NDANNYQYDKCKLKSVSQNINEAEGILADQKKRFRLFGVEICNEEDNVGLGQEEEHGLGL
YEAQLLEWKDELATVDPAITSMRFDRLTSRYTIEDD
Download sequence
Identical sequences MDP0000534780 MDP0000534780|PACid:22663807

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]