SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000549646|PACid:22624756 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000549646|PACid:22624756
Domain Number 1 Region: 53-321
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.74e-49
Family Thi4-like 0.0000000024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000549646|PACid:22624756
Sequence length 359
Sequence
MASMTSTLTSSSLTTKLQKPSLLDSSFHGAPMVRLQPAKAAPASNGGLSVSMSANGLNPS
YDLSAFKFDPIKESIVSREMTRRYMTDMITYADTDVVVVGAGSAGLSCAYELSKNPDVQV
AIIEQSVSPGGGAWLGGQLFSAMVVRKPAHLFLNELGIDYDEQDNYVVIKHAALFTSTIM
SKLLARPNVKLFNAVAAEDLIIKGGRVGGVVTNWALVSMNHDTQSCMDPNVMEAKVVVSS
CGHDGPMGATGVKRLRSVGMIESVPGMKALDMNTAEDAIVKLTREIVPGMIVTGMEVAEI
DGSPRMGPTFGAMMISGQKAAHLALKALGLPNALDGSYVGGIQPELILAAAESAEIAEA
Download sequence
Identical sequences MDP0000549646 MDP0000549646|PACid:22624756

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]