SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000560468|PACid:22676715 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000560468|PACid:22676715
Domain Number 1 Region: 96-194
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 5.89e-27
Family alpha-D-mannose-specific plant lectins 0.0029
Further Details:      
 
Weak hits

Sequence:  MDP0000560468|PACid:22676715
Domain Number - Region: 407-438
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.000824
Family Pan module (APPLE domain) 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000560468|PACid:22676715
Sequence length 455
Sequence
MASKTSHSAVLLLFSLIAFLFAIPIQAQVPANLTFKFINQGKLGDGNIEYHATYRVIQTN
SHTFYTNPFGLCFYNTTPDSYIFAIRAGVPNDEVRWVWDANRNHPVHEKATLSFGKEGNL
VLGEADGTVVWQTNTANKGVTGIKLLQNGNLVLHDKNGRFIWQSFDYPTDTLLVGQSIRT
NGRNKLVSRKSDTDSSDGSYSMVLDKTGFGMYLNNAGQRLIYGGWTGTDYGSTVTFDCQT
TNGFEDAIAYELVFNVNQDINAPPPPPQSKRRLLQVRPVGSATQINLNKLNYNATYSFLR
LGSDGNLKAYTYYXKVNSMNWEESFAFFSNYFIRECALPSKCGSYGYCSRGMCVGCPSPK
GLLGWSKGCVAPKLGQCKSGAKANYYKVADVEHFLSPYLDGGDGPMKVGECRAKCDKDCK
CLGFFYREDTSKCLLAPVLGTLIKDVNTSAGYIKY
Download sequence
Identical sequences MDP0000560468 XP_008386253.1.92800 MDP0000560468|PACid:22676715

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]