SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000568104|PACid:22648607 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000568104|PACid:22648607
Domain Number 1 Region: 293-388
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.25e-24
Family Protein kinases, catalytic subunit 0.0027
Further Details:      
 
Domain Number 2 Region: 53-160
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 6.94e-24
Family alpha-D-mannose-specific plant lectins 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000568104|PACid:22648607
Sequence length 389
Sequence
MSITVLLETDAYLLISLEKLTKFSPSTFHNFLNHIPEYLLSIRVHVHKKIRDLVWVXXRK
XPASDSYSSXLQLFRNGSLXLLDRTKYTIWSTRSAAAVSNSTIAVLLDNGNFVISDESDS
SAVLWQSFDHPTDTWLPGAKLGYNKLTKEKLILTPWRNPQNXAPGIFSLEIEQAGSRXFL
FRNGSAISIWDWQGDNHYCFYCQVNLNSXVNENESSLTYVPIDPNSFVRYKLLNGLLKFY
NGSETIDTWGALGQCTNDVSCGAFSICDXQNLPHCRCLEGFEPKSQKIGNLEGILPNSTA
IAVKELKYLEQGEKQFHAEVGTISTIHHINLVRLWGFCAETSKRLLVYEYMPNGSLQSLF
HQENALMLDWKDRYHIAMGIARGLAYLHE
Download sequence
Identical sequences MDP0000568104|PACid:22648607 MDP0000568104

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]