SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000613879|PACid:22654645 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000613879|PACid:22654645
Domain Number 1 Region: 82-197
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 1.7e-21
Family alpha-D-mannose-specific plant lectins 0.0053
Further Details:      
 
Weak hits

Sequence:  MDP0000613879|PACid:22654645
Domain Number - Region: 447-485
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.000192
Family Protein kinases, catalytic subunit 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000613879|PACid:22654645
Sequence length 487
Sequence
MRKLTMNSTKFFFVSTVLFLFLVILPSSISVTLDAITPNQPLREGDVLLSTTEFFALGFF
KPGNSHNRYIGVWYNKIPIKTIVWIANRENPIVPTAGTGLLAIHADHGGLVMYGEDQNTP
FWSTNLTVSSPNNSVIAKLWDTGNLVVVEINGGSSEKVLWQGFDYPTNTMLPFMKXGLDR
RSGLNWFLTSWKSQDDPGMGNCSYRIETSESPQGFLYMGQTPLWRTGPWIGERWSGVPQI
KKTFYSNXTFVNTQDEVSIMDGTVYESIFFKMVINESXNIERSAWXDNKWVPYWSPDXQC
DFYGKCGPNSICYPNPNFADKFECKCLPGFEPKLQHEWYLGDWSGGCVRQKGSSVCQNGE
GFLKLESVKVPDTSTARVNMXRSGEACKEECLRNCSCTAYANADERQGGSGCKRSQDKLF
NVTIASTSWEDSSARTNIDESGINSELPFFELSTIVKATXNFASNNKLGXGGFGSVYKVL
NKSGRVK
Download sequence
Identical sequences MDP0000613879|PACid:22654645 MDP0000613879

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]