SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000615069|PACid:22627503 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000615069|PACid:22627503
Domain Number 1 Region: 82-192
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 9.42e-21
Family alpha-D-mannose-specific plant lectins 0.0041
Further Details:      
 
Weak hits

Sequence:  MDP0000615069|PACid:22627503
Domain Number - Region: 370-427
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00824
Family Hairpin loop containing domain 0.07
Further Details:      
 
Domain Number - Region: 295-325
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0126
Family EGF-type module 0.084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000615069|PACid:22627503
Sequence length 461
Sequence
MRKLTMNSTEFFFVSTVLLXFLVILPSSISVTXDAITSXQPLREDDVLLSTTKIFALGFF
KPGNSRNRYIGVWYNKIPIKTIVWIANRENPIVPTAGTGLLAIHGDHGGLVIYGEDQNTP
IWSXNLTVSSPNNSVIAKLSNKGNLVVEINGEKVWQGFDYPTNTMLPFMKIGLDRRSRLN
RFLTSWKSQDDPGMGNCSFRMEPSESPQEFLYKGQTRLWRTGPWTGERWSGVPAMVKLFF
TNVTFVNNQDEVSIMXXVXESSFVKXVIDESGNIXRSXWDDEVHKWVPHWSPDWQCDSYG
VCGPNSICYPNFXDKFECKCLPGFEPKLQHEWYLRDWSGGCVRQKGPSVCQNGEGFVKLE
RVKXPDTSTARVNMSXSREACKEECLRNCSCTAYANADERQGGSGCITWHGDLMDARTYL
DTGQDLYVRVDANVSGIFXLSIYLLSSLFLINNSPHNTEVP
Download sequence
Identical sequences MDP0000615069|PACid:22627503 MDP0000615069

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]