SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000671114|PACid:22638724 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000671114|PACid:22638724
Domain Number 1 Region: 9-95
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.00000000278
Family Thi4-like 0.0000872
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000671114|PACid:22638724
Sequence length 250
Sequence
MSANGLNLSYDLSAFKFDPIKESIVSREMTRXYMTDMITYADTGIIVVGXGSAXLSCTYE
LSKKPDVQVAITEQSVSXGGGAXLGGQLFSAMDSDPKPHTTYGRPXRKXGQSTRTQNRIF
IENIYENXRKSTYEVYDQEERRRKRVQRASDDEENRSTRKELGRRSDWGWRGVGAAKRRN
DXRLGNIIDXCGHHCVCPVVVVRFPXDDNCGIADGGFGAPXVAAAVVXVKENEEEEAXIK
XVLKEXQQNN
Download sequence
Identical sequences MDP0000671114|PACid:22638724 MDP0000671114

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]