SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000695365|PACid:22667605 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000695365|PACid:22667605
Domain Number 1 Region: 67-176
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 1.2e-22
Family PHBH-like 0.018
Further Details:      
 
Weak hits

Sequence:  MDP0000695365|PACid:22667605
Domain Number - Region: 29-63
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.00971
Family FAD-linked reductases, N-terminal domain 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000695365|PACid:22667605
Sequence length 180
Sequence
MEFVNRLEDWTKLIKISDPMEEGCRLGPVVSKGQTNEIIEIVGDLLVAADGCLSSIRQSF
VPDHKLRYSGYCAWRGVLDFTGNESXETLTGIRREYPXLGKCLYFXLGSGTHTVLYELLN
RRLNWIWYVHQPEPDLKHNSMTMKATSNMIQSMHKEAEKMWLPEFVRVIKETKEPFSWLE
Download sequence
Identical sequences MDP0000695365|PACid:22667605 MDP0000695365

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]