SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000727481|PACid:22682921 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000727481|PACid:22682921
Domain Number 1 Region: 29-87,117-230
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 1.44e-34
Family GMC oxidoreductases 0.00064
Further Details:      
 
Domain Number 2 Region: 1-26,229-284
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.00000000000000185
Family FAD-linked reductases, N-terminal domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000727481|PACid:22682921
Sequence length 291
Sequence
MLSGVGPAEQLKAHNITVVVDQPMVGQGMSDNPMNAIFVPSPIPVEVSLIQVVGITHFGS
YIEAASGENFAGGSTTKDFGMFSPKIGQLSTVPPKQRTPEALAEAVRYMDSLEDAAFXGG
FILEKVMGPISTGHMELRTRNPNDNPAVTFNYFKEPQDLERCVQGIETIEKIXESKAFSK
FRYEGMSIAALLNATASSPVNLLPKHANASRSLDQFCKDXVMTIWHYHGGCQVGRVVDHD
YKVLGVDALRVIDGSTFNYSPGTNPQATVMMLGRYMGKTILDERLASDVSN
Download sequence
Identical sequences MDP0000727481|PACid:22682921 MDP0000727481

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]