SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000730194|PACid:22627167 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000730194|PACid:22627167
Domain Number 1 Region: 52-164
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.00000000034
Family alpha-D-mannose-specific plant lectins 0.019
Further Details:      
 
Weak hits

Sequence:  MDP0000730194|PACid:22627167
Domain Number - Region: 182-220
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.0791
Family alpha-D-mannose-specific plant lectins 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000730194|PACid:22627167
Sequence length 328
Sequence
MAIINLVFLIIFACLWSSHDGRDTLKQGDTLNSSSSLLSSYHHGDSATANGAWIGNRDSP
VLYPSSPLLTLDFNNTLKISQTDEDQDPIVVCSAPHTSNSNTSVVATLLDSGNLVVLQQV
NSVDGSMNRVFLRQSFDYPIDTFLPGMKLGVNHRNGHIWSLSSWLGIFIPAPGPFTLDWD
PNQGHLKLRRKGVIFWTSGVLKSDGRFEYILSDDSMMKYRFSFVSNENEDYVTYTAAEGG
SPQELVLYPFGSLYEYRVQLDVAQAEKCDGYNTEGGCVKKDRPSECMKEFGGEFELKNGS
FEPSNITNTSRDPYWFGSSNTDCKATCW
Download sequence
Identical sequences MDP0000730194|PACid:22627167 MDP0000730194

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]