SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000789642|PACid:22644538 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000789642|PACid:22644538
Domain Number 1 Region: 192-254,322-404
Classification Level Classification E-value
Superfamily SET domain 2.22e-28
Family Viral histone H3 Lysine 27 Methyltransferase 0.097
Further Details:      
 
Domain Number 2 Region: 20-137
Classification Level Classification E-value
Superfamily TPR-like 1.41e-16
Family Tetratricopeptide repeat (TPR) 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000789642|PACid:22644538
Sequence length 544
Sequence
MREEAQQQDQLAMATAEEKLQQLRSKATELLLREEWQESVQAYSHFITLCQSHISNFPQN
PNPDPDHLPKLRKSLCLALSNRAEARSRLRDFAEALRDCDRALEIERAHFKTLVCKGKIL
LNLNRYSMALDYFRTAQLDPRANGSSVDLDGYLQKSKKLELMSRTGAFDLSEWVXNGFRG
KPLEPAEYIGAVQIKKSEIRGRGLFVTKNIDAGTLVLVTKAVATERGIFPGQDLDENTQL
VMWKNFTEKVMDSMAKCLRIRDLISTLSSGEDEDELEVPEINRFKPEAKHNGGCHNEKEH
DASRILSILDVNSLVEDAVSSKVLGKNNDYYGVGLWVLASFINHSCVPNARRMHVGDYVM
VHASRDVKAGEEITFAYFDVLSPLEKRNESSKTWGFRCNCKRCKFEEKLYSREDLREIEM
GLERGMDAGAVVYKLEEGMRRWMVKEREKGYLRASFWEACSQAYYSEKSAKGWGRRIPPM
ETVVDSVVEAVGSDERVLKMVAEKLKGRGGGMVEMERAMKLGRGVYGKVVKKQAMKTLLG
LDIL
Download sequence
Identical sequences MDP0000789642 XP_008389453.1.92800 MDP0000789642|PACid:22644538

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]