SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000809983|PACid:22676356 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000809983|PACid:22676356
Domain Number 1 Region: 495-793
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 8.09e-78
Family Protein kinases, catalytic subunit 0.00015
Further Details:      
 
Domain Number 2 Region: 66-215
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 8.64e-21
Family alpha-D-mannose-specific plant lectins 0.0025
Further Details:      
 
Domain Number 3 Region: 176-287
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.0000173
Family alpha-D-mannose-specific plant lectins 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000809983|PACid:22676356
Sequence length 809
Sequence
MAVPLSVEMLLFSSLFLLPISVFSQNNGRVAVGSSLTASTGDSSSWLSPSGDFAFGFSPL
GNNDLFLLSIWYAKIPETVVWHAYEDNNPVVAPGGSILNLTANSGLVLNNPQGGEIWKSG
TTSRIVANGVMNDTGNFVLQDKNSGSLWETFSNPTDTVLPGQTIERNGKLSSRRSETNYT
KGRFQLRLQDDGNLVLNTVNLPSDFANNPYFATDTTAGTVEGSEGKQLVFNSSGYMFVLR
ENGGRFILTRTQGVSTRDNYIRATLDFDGIFALYSHPKNFTGKASWSTPWYMPDGDICQT
LREDTGVGVCGYNSICKLKTDNRPTCECPKGFSFLDPNDIYRGCSSNFIQSCEEDELQGP
RKDLYVEVLANTDWPTSDYVQLKPSTADNCNESCFQDCLCAVAVFRSETCWKKKLPLSNG
RVDVSLNSQTFIKVRKDNATLQSPPKPIPDDKEKSRKSVIRVESVLLGTSIFFNVVLSSA
LCLGFFYIFRKKPVRPSTDIVLDSNLRSFSYEELLEATNGFKEELGKGAFGVVFKGVMQI
SPGVEVAVKKLNCFTGNTVDVEKEFKTEVNVIGQTHHKNLVRLFGYCDEGQQRLLVYEFL
SNGTLASFLFSDIKPSWRQRIEIAYGVAKGLLYLHEECRTQIIHCDIKPQNILLDDYYTP
LISDFGLAKLLLMNQSQTLTAIRGTRGYVAPEWFRSLPITTKVDVYSFGVVLLEIICCRR
SVDNEGNCEEKAILTYWVYDCYIEGALDDVVDHEVEALCDRTILEKFVMVAIWCIQEDPS
LRPTMMKVVQMLEGVAEVPVPPCPSPYTR
Download sequence
Identical sequences MDP0000809983|PACid:22676356 MDP0000809983

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]