SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000817733|PACid:22658303 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000817733|PACid:22658303
Domain Number 1 Region: 71-165,193-210
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 8.9e-29
Family alpha-D-mannose-specific plant lectins 0.0021
Further Details:      
 
Weak hits

Sequence:  MDP0000817733|PACid:22658303
Domain Number - Region: 385-417
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.011
Family Pan module (APPLE domain) 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000817733|PACid:22658303
Sequence length 440
Sequence
MSSPQLIMSLPCMFIFSLFAFIAQAKVPANQTFKYVNEGEFGPFITEYDASYRMLDPFAS
PFQLAFYNTTPNAFTLALRMGLRRSESQFYWVWEANRGKPVGENATFTFGTDGNLVLANA
DGRVAWQSNTANKGVVGFDLLSTGNMVLYDSKGNFVWQSFDYPSNTLLVGQSLRAGGVSK
LVSRASEAENEDGSYSLVMEAKGLAMYYKSKNSPRPSLYFTSSKWISVQKGSLNHVTLKC
SPDAHEGFAYDLSLDYVAGNSSSRGNVMLARPNYNSTSTFLRLEMDGNLRLHTYYKVVRY
GAWEVTFTLFDKDSRWENGCQLPERCGKLGICEDSQCVACPSSKGLLGWSESCEPEKLTS
CDPKSFHYYKVEGVDHFLSKYAKGDSIKESDCAKKCTLDCKCLGYFYNQDTSKCWIAYDL
KTLTKVANSTHVGYIKAPNH
Download sequence
Identical sequences MDP0000817733 MDP0000817733|PACid:22658303 XP_008367970.1.92800

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]