SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000817734|PACid:22658302 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000817734|PACid:22658302
Domain Number 1 Region: 94-169,197-217
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 7.2e-26
Family alpha-D-mannose-specific plant lectins 0.0027
Further Details:      
 
Weak hits

Sequence:  MDP0000817734|PACid:22658302
Domain Number - Region: 407-438
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.000863
Family Pan module (APPLE domain) 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000817734|PACid:22658302
Sequence length 457
Sequence
MATKTSLSAVFLFSFIAILFAIPIQAQVPTNQTFKFINQGELGGGIVEYHATYRVIQTNS
HTFYTHPFGLCFYNTTPDSYILAIRAGVPKDEVRWVWDANRNHPVREKATLSLGREGNLV
LGEADGTVVWQTNTANKGVTGIKLLGNGNLVLHDKNGRFIWQSFDYPTDTLLLGQSVTTN
GRNKLVSRKSDTDGSDGPYSIVLDHTGFTMYLNDTGQRLIYGGWTGTDYGSTVTFDFDIM
DGFDDGIAYELVLNVNQDINAPPPPPPQSHRHLLQVRPIGNAHQINLNKLNYNATYTFLR
LGSDGNLKAYTYYDKVRNMKWEESFAFFSSYFIRECALPSKCGSYGYCSRGMCVGCPSPK
GLLGWSKGCAAPKLGQCKSGAKASYYKVADVEHFLSPYLDGGDGPMKVGECRAKCDKDCK
CLGFFYREDTSKCVLAPLLGTLIKDVNTSVGYIKYSK
Download sequence
Identical sequences MDP0000817734 MDP0000817734|PACid:22658302 XP_008367995.1.92800

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]