SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000837610|PACid:22643529 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000837610|PACid:22643529
Domain Number 1 Region: 6-90
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.000000000881
Family FAD-linked reductases, N-terminal domain 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000837610|PACid:22643529
Sequence length 136
Sequence
MQNKSMPATPVPTPGAILLGDALNMRHPLTGGGMTVALSDIVLLRDLLRSLSDLNDAPAL
CEYLESFYTLRKPVSSTINTLAGALYKGASGIIFPIIKDEGVRQMCFPATIPAYYKALPL
QMKNREQADKFQSYSF
Download sequence
Identical sequences MDP0000837610 MDP0000837610|PACid:22643529

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]