SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000919183|PACid:22661837 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000919183|PACid:22661837
Domain Number 1 Region: 282-450
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.74e-21
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0055
Further Details:      
 
Domain Number 2 Region: 112-304
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 4.32e-19
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000919183|PACid:22661837
Sequence length 550
Sequence
MALERIARTARNGFRRSSSGASARTIEKDMLCERASTRNYCSVPSLESETRNNNLSYLSS
ISKVNHNRFWSRGISITPNYQFPSAERIVEESDSECNEPKYPGLEATRPGEKPRVVVLGT
GWAACRFLKGLDTKVYDVVCISPRNHMVFTPLLASTCVGTLEFRSVAEPVSHIQSAMATS
PNSYFYLASCVGLDTDKHEVYCETVSNGGLSHEPYRFKVAYDKLVIAAGAEPLTFGIKGV
KEHAFFLREVNHAQEIRKKLLLNLMLSEHPGILEEERKRILHCVVIGGGPTGVEFSGELS
DFIMKDVQERYTHVKDYIXVTLIEANEILSSFDVGLRQYATNHLTKAGVRLMRGVVKEVH
PKKIVLNDGTDVPYGLLVWSTGVGPSEFVKKLNLPKSPGGRIGVDGWMRVPSVEDVFALG
DCAGFLEHTGRPVLPALAQVAEREGKFLVELFNRIGKQDAGKAFSARDIPLGKQFVYKHL
GSMATVGGYKALVDLRQSKDAKGISLAGFLSWFIWRSAYLTRVVSWRNRFYVAVNWATTL
VFGRDNSRIG
Download sequence
Identical sequences XP_008383805.1.92800 XP_008383807.1.92800 XP_017190311.1.92800 MDP0000919183|PACid:22661837 MDP0000919183

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]