SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000948298|PACid:22676144 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000948298|PACid:22676144
Domain Number 1 Region: 2-85
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.000000958
Family FAD-linked reductases, N-terminal domain 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000948298|PACid:22676144
Sequence length 175
Sequence
MRHPLTGGGMTVALSDIVVLRNLLRPLHNLNDAPALCKYLESFYTLRKPVASTINTLAGA
LYRVFCASPDPARMEMRQACFDYLSLGGXFSNGPLALLSGLNPQPLSLVLHFFAVAVYAI
GRLLLPFPXPKRMWIGARLVXGASGIIFPIINSEGVRQMFFPVTVASYYRTPPIN
Download sequence
Identical sequences MDP0000948298|PACid:22676144 MDP0000948298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]