SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Chlre4|412995|pasa_Sanger_mRNA11163 from Chlamydomonas reinhardtii 4.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Chlre4|412995|pasa_Sanger_mRNA11163
Domain Number 1 Region: 12-157,270-347
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 4.97e-41
Family PP-loop ATPase 0.0042
Further Details:      
 
Domain Number 2 Region: 394-483
Classification Level Classification E-value
Superfamily MesJ substrate recognition domain-like 0.000000575
Family MesJ substrate recognition domain-like 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Chlre4|412995|pasa_Sanger_mRNA11163
Sequence length 603
Sequence
MHARLQSHLRSTGLLEGVDSVLVAVSGGQDSVCLLQLLADLRHLYSWRRLGVVHCDHRWR
TDSAANAAFVVELATQRLGLEAEDVHVEVAAPGQARCERSAREWRYHVFSRVAAECGYGA
VVTAHTSTDRRTMLLNLLRGAGPSGLVALSRNRPLPPPPFSERAASRRRQESLPVPQRPQ
GPTFGPLPGPGLGPAAAHGPCGGDTVRGASSEALPRAAAASADCTCNTGSCVCGGAGSGT
AQPGASNSSSSKCSSSRNRTNSSIGGSGPVRLVRPLLQFAREETLAFVQQAGLPHFHDST
NDHNEHRRNRLRNEVMPQLRAGFNPRLDLALTRFMEVLEPEVEFVEDMAELAYGRVCRPE
ADVASRGHGGVAAAAPAQRAEEGGANSAEALDGRQEAACQEALKLSALRKLPLALQRRVL
HSWLARELARRRRSLRAGPSAAAGVGFDDVARCLKLLVGTTPQGAVSDQLCGGLVAVVDG
EWLRLRAARELADWQQQVQAQRRKEQQERKQLRQQQQRQQLAMQTLRVRVARRLRESQEE
LEAMQAATAQQPEAGAGTDTHGLVMRYLQRLHRVQQELHELDELARDVLGSPSHEREQAS
LTN
Download sequence
Identical sequences jgi|Chlre4|412995|pasa_Sanger_mRNA11163 3055.JGI412995

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]