SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Chlre4|409762|pasa_Sanger_mRNA16257 from Chlamydomonas reinhardtii 4.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Chlre4|409762|pasa_Sanger_mRNA16257
Domain Number 1 Region: 679-809
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.000000122
Family alpha-D-mannose-specific plant lectins 0.0029
Further Details:      
 
Weak hits

Sequence:  jgi|Chlre4|409762|pasa_Sanger_mRNA16257
Domain Number - Region: 155-249
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 0.0855
Family Reprolysin-like 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Chlre4|409762|pasa_Sanger_mRNA16257
Sequence length 1178
Sequence
MLPPPGSSSTTASRSGDTSGAHQFVYNTNRLRMDDVSTVIFITNMCGYGPAMTVEELEAR
LFGTAEPSSEADMSVQRYMSSCSNTQATFSRDNVLIVGPVDLDCDGSTWDLAWSTSSCFE
NDYVGWQWAAEEWAYGQDIDISSYRHRVIITSPGKANWMTAGDPDCAWSGMGVLGPAYNA
AGEQNMDGTAVYSQGVFSYAWVSGDHWDRPQGWLHELGHNYYLHHATSLGCGSAYCDDSC
TMGYCCTPRCFNAPHNWQVGWDDPTALLGDWDLSPGVANRYTLVSGLGRDAAPARVRSGA
VLRVEAAWAGVDDGGVGTTLWVSYRAGGSVYDELPDELTDRVLIYWYPGSDPNDATVTVR
LAALAEGEVWRNDTLLLSVTRKAPSGAGAAAAAAAGGGAQVVLCRYSGDVETECGDGLDD
DCDGLIDMDDPDCTDGVVQPPDAPSPVAEPSLTDSPPPTTPESPPPLESPPPPPPPPPPP
PPPSPSPQPPSPPPKARPPKTPNAPSPPEPPTPPFNPLQPPDTPNAPPDVPPPGAPPPDA
PDAPPDAPPLAPQRPPLAPAPPLPPPAGPVLPLIPLAPSVYELAPNRPPPLPASPARPSS
PTAPPPPPSPPPFAWPGLCLTAAYNDGCSTNTVPQPPLLSCPAAAAANGSSSSCYLTALN
ASLLNGTLQPGSLASCNGLTSPSGKYRLVVQDDGNLVLYNLQTSQPAAAPAVQWASNTTG
VAAAAGPVVLKLWLNGTLGLVWYRRDAKSATGWRVAAVRNTAPNGGLQGGVYGGGAAGAA
NGPFALNVRDDGRAYVQNKAGAVVWATSDPGGPAAFSAIAPPSPVYGGPLPPVLSVPSPS
SPSPSSSSSPSPDPSPSPAQVVPASPELSNPELSPSPEPPSPVPPSPSPPSPEPPSPEPP
SPEPPSPEPPSPEPPSPEPPSPEPPSPEPPSPEPPSPEPPSPEPPSPEPPSPEPPSPEPP
SPEPPSPEPPSPAPRTPVSPPPPRAAVAKLSAPPLVFAPQPPSPPSPSPPSPPLPVPATP
SPVASPLPSPVPSPSPLVASPLPSSLPPPVPSPPQAASPSPSPTATSSPAQLPAVPSPAI
SSPPLPAPSPSQTASSPAVATPSPSASPPPPTAAVPASSSPSPTNANATGGAPAAVATSR
APSPPNSQQRRSLQSAKAQAAVASESWAAEAVGGDDEA
Download sequence
Identical sequences 3055.JGI409762 jgi|Chlre4|409762|pasa_Sanger_mRNA16257

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]