SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|90021200|ref|YP_527027.1| from Saccharophagus degradans 2-40

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|90021200|ref|YP_527027.1|
Domain Number 1 Region: 2-133
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 7.72e-37
Family SMI1/KNR4-like 0.0000101
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|90021200|ref|YP_527027.1|
Sequence length 134
Comment conserved hypothetical protein [Saccharophagus degradans 2-40]
Sequence
MINEIAEMLAARSLKTAYPLELPTMDDIVEAHEAMLISVPADFRDYLLHSSNCIYGRLEP
VTVADRNSHTYLPEVAAEAWSRGMPREMIPLCVDGDNVYCVAEDGEVFLWEGDDDMESVA
EDVWQWVRDVWLES
Download sequence
Identical sequences Q21KG4
203122.Sde_1553 WP_011468035.1.82451 gi|90021200|ref|YP_527027.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]