SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|90022349|ref|YP_528176.1| from Saccharophagus degradans 2-40

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|90022349|ref|YP_528176.1|
Domain Number 1 Region: 14-155
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 7.09e-51
Family Ribonuclease PH domain 1-like 0.0000171
Further Details:      
 
Domain Number 2 Region: 303-500
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 5.57e-47
Family Ribonuclease PH domain 1-like 0.0000181
Further Details:      
 
Domain Number 3 Region: 462-561
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 2.78e-29
Family Ribonuclease PH domain 2-like 0.0001
Further Details:      
 
Domain Number 4 Region: 156-247
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.42e-26
Family Ribonuclease PH domain 2-like 0.0011
Further Details:      
 
Domain Number 5 Region: 568-652
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 2.28e-24
Family Eukaryotic type KH-domain (KH-domain type I) 0.0029
Further Details:      
 
Domain Number 6 Region: 632-714
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 8.21e-22
Family Cold shock DNA-binding domain-like 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|90022349|ref|YP_528176.1|
Sequence length 722
Comment Polyribonucleotide nucleotidyltransferase [Saccharophagus degradans 2-40]
Sequence
MQWGTPSQKDKKVNPVIKKFQYGNDTVTLETGRIARQASGAVLASMGQTSVLVAVTGSKE
AKPGQDFFPLSVHYQEKAYAAGKIPGGFFKREARPSEKETLTSRLIDRPIRPLFPNGFLN
EVQVVCTVISAEKDVDPDIVAMIGTSAALAISGIPFNGPIGAARVGYTQESGYLLNPTYS
TLKTSELDMVVAGTADAVLMVESEAKELPEDIMLGAVLYAHQEMQAVVQAVAELAKDAAK
PVWDWKPEEVNAELKAKVEHGFADSVGVAYRITDKQKRYDRLSELRNQAVAELATEESGV
SADEVKGLFAKIEKQIVRSRVVAGEPRIDGRDSKTVRPLHVEVGVLPKVHGSALFTRGET
QALVVSTLGSARDAQIIDALEGERKDPFMLHYNFPPYSVGECGRMGATGRREIGHGRLAR
RGIGAVLPKEEDFPYTMRVVSEITESNGSSSMASVCGASLALMDAGVPLKAPVAGIAMGL
VKEDNGFAVLTDILGDEDHLGDMDFKVAGTADGVTALQMDIKIEGITEEIMEIALGQAMD
ARLHILAEMNRVIASPRKELSENAPQFHTMKIDPDKIRDIIGKGGATIRSITEETGASID
IDDNGTIKIYADDGDGMQAAIARIEEITAEAEIGAVYQGKVVRIVDFGAFVNFLPGKDGL
VHISQIAHERVQNVSDYLKEGQDIEVKCMDIDQRGRIKLSIKELLPAPEAETAEAPAGEG
EE
Download sequence
Identical sequences Q21H65
gi|90022349|ref|YP_528176.1| 203122.Sde_2704

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]