SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|89893200|ref|YP_516687.1| from Desulfitobacterium hafniense Y51

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|89893200|ref|YP_516687.1|
Domain Number 1 Region: 3-111
Classification Level Classification E-value
Superfamily N-utilization substance G protein NusG, N-terminal domain 1.14e-44
Family N-utilization substance G protein NusG, N-terminal domain 0.0000269
Further Details:      
 
Domain Number 2 Region: 119-174
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 1.93e-17
Family N-utilization substance G protein NusG, C-terminal domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|89893200|ref|YP_516687.1|
Sequence length 175
Comment hypothetical protein DSY0454 [Desulfitobacterium hafniense Y51]
Sequence
MTKNWYVIHTYSGYENKVKTNLEKRVESMNMEDKIFRVLVPMEDEIEIKNGKKKIAKRKV
FPGYVLVEMDMTDDSWYVVRNTPGVTGFVGTGAKPIPLLDHEVQAILKQMGVEEVRTRVD
YTVGQNVRVISGPFKDFIASVREILEDKGKLRVSVSMFGRETPVELDFAQVEKVD
Download sequence
Identical sequences A0A098AV64 A0A1M7S340 B8G1U9 G9XK26 Q250P9
138119.DSY0454 272564.Dhaf_0405 gi|89893200|ref|YP_516687.1| WP_005810198.1.13927 WP_005810198.1.73069 WP_005810198.1.80252 WP_005810198.1.85503 WP_005810198.1.94859 gi|219666473|ref|YP_002456908.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]