SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|302385733|ref|YP_003821555.1| from Clostridium saccharolyticum WM1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302385733|ref|YP_003821555.1|
Domain Number 1 Region: 720-779
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.0000000000000235
Family Type I dockerin domain 0.0011
Further Details:      
 
Weak hits

Sequence:  gi|302385733|ref|YP_003821555.1|
Domain Number - Region: 348-455
Classification Level Classification E-value
Superfamily Lysozyme-like 0.0172
Family Bacterial muramidase, catalytic domain 0.086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|302385733|ref|YP_003821555.1|
Sequence length 780
Comment SH3 type 3 domain-containing protein [Clostridium saccharolyticum WM1]
Sequence
MKKYRKARKMAIILASVLVMDSYTGVISPYINTYAYTEKAATVNATSLNVRSGPGTTYSV
VTKLTNGASVTVIDEKNASDGALWYQIRVSGSGGQKVTGYVSKSFLRFPASYTNDADFES
RLTAEGFPESYKVRLRALHAQYPKWVFRAQHTNLDWNTAVKEESLAGKTLVHTNSLSSWK
STIDGAYNWDTSTWIGYDGSSWVTASADIVKYYMDPRNFLDETNVFQFMTHTYDSSKHTA
DGLKTMVKGTFLSGESSGGSGGNGSTPGNTDSSGGGTVIGPGAAIGPGASVSPSTGAAQD
SGSGKASLEGPQASITPKNLPVLMEYGPGASLSGPSSSNSSGTVTGSSAYVNMIMNAAAQ
SGVNPYVLAAMIIQEQGSSGAGKSISGKEPGYEGYYNFFNIEAYQSGSMTAVQRGLWWAS
QSGNYERPWNSPEKSILGGAFYYGNNYVKVGQDTFYLKKFNVQGSNLYKHQYMTNVQGAA
SEGAVYSKAYNSDMKQTELEFKIPVYNNMPDNPCSQPTGDGNPNNKLSGLSVEGFAMTPT
FSRDTLEYNLIVDPGVSSINLYATPLSSLASVNGTGTITLSNGNNDIKVAVTAQNGSVRE
YVLHVVRQSNGPTYSSGVGASPGGNASSGQGSSSSGGNPSSGPGSSSGPGVSKPSGTDNA
GTPGGSNVTIAPNGSANISVQTSTGVISQGPGTDIKVTEAALGSPQQTQASAAAGQSSAY
AKGDINGDGKINSLDTLKLQRYLLGLETIPEKGMLSADFNGDGKVNSQDLLLLQKKILGL
Download sequence
Identical sequences D9R8V7
WP_013272027.1.20439 gi|302385733|ref|YP_003821555.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]