SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|94985746|ref|YP_605110.1| from Deinococcus geothermalis DSM 11300

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|94985746|ref|YP_605110.1|
Domain Number 1 Region: 129-172
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.00000549
Family Type I dockerin domain 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|94985746|ref|YP_605110.1|
Sequence length 178
Comment hypothetical protein Dgeo_1646 [Deinococcus geothermalis DSM 11300]
Sequence
MKALIRPLLLALSLTAGAQAATVKFRPQGAQLTQAVQAALAAISTKETPITLDTSGGPIL
TLGGSGASAVPFNPDVVARTLSVGGERRIELNPQGPLPLAEAIRTTLASELGLKEWTVAA
ARTRLSGADLNGDGVIDLADLALLMENYGKTGAVLGDLNQDRKVDDADVRLFSAQYQP
Download sequence
Identical sequences Q1IXU3
gi|94985746|ref|YP_605110.1| WP_011530775.1.71355 319795.Dgeo_1646

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]