SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|94985083|ref|YP_604447.1| from Deinococcus geothermalis DSM 11300

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|94985083|ref|YP_604447.1|
Domain Number 1 Region: 135-402
Classification Level Classification E-value
Superfamily Subtilisin-like 3.14e-78
Family Subtilases 0.00000373
Further Details:      
 
Domain Number 2 Region: 53-131
Classification Level Classification E-value
Superfamily Protease propeptides/inhibitors 0.000000000021
Family Subtilase propeptides/inhibitors 0.0048
Further Details:      
 
Domain Number 3 Region: 447-511
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.0000122
Family Collagen-binding domain 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|94985083|ref|YP_604447.1|
Sequence length 514
Comment peptidase S8/S53 subtilisin kexin sedolisin [Deinococcus geothermalis DSM 11300]
Sequence
MNSRLALGLLGLTLLLAACGQQANTPADTAQASTPDRSSHTAPLLGTSNPEAIPGQYIVV
FSDGALGANLGAQDAGSLIRTLGLDPQGISVQHIYTQALSGFAAKLSAQNLAKLQADRRV
KYIEQDATVHATATQSGATWGLDRIDQRNLPLDGNYSYSTTASNVTAYIIDTGINTAHTD
FGGRAVWGTNTTGDGNNSDCQGHGTHVAGTVGSSTWGVAKGVKLVAVKVLGCDGSGTNSG
VIAGVNWAVSNKSGPAVANMSLGGGVSQALDDAVNNAASKNLVMAVAGGNDNVDACTSSP
ARAANAITVGATDRNDARASFSNYGSCLDLFAPGVNITSTWIGSTTATNTISGTSMATPH
VTGAAALILAANPSYTTAQVTSALLNNATTGKVTSAGSGSPNRLLYTGSGSTTPAPGTST
TYSGSVSQGSSSWKPSTSGFSYAGGTLRGTLSGPSGTDFDLYLQKYNGSSWVDVAASEGS
SSSESINYVAGSGTYRWEVYAYSGSGSYTLVETK
Download sequence
Identical sequences Q1IZQ6
WP_011530115.1.71355 gi|94985083|ref|YP_604447.1| 319795.Dgeo_0978

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]