SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000000445 from Dasypus novemcinctus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000000445
Domain Number 1 Region: 6-289
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 2.95e-76
Family BAR domain 0.0059
Further Details:      
 
Domain Number 2 Region: 392-571
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 4.32e-51
Family BCR-homology GTPase activation domain (BH-domain) 0.0000000182
Further Details:      
 
Domain Number 3 Region: 265-365
Classification Level Classification E-value
Superfamily PH domain-like 3.36e-18
Family Pleckstrin-homology domain (PH domain) 0.013
Further Details:      
 
Domain Number 4 Region: 665-685,759-814
Classification Level Classification E-value
Superfamily SH3-domain 1.42e-16
Family SH3-domain 0.0000375
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000000445   Gene: ENSDNOG00000000580   Transcript: ENSDNOT00000000583
Sequence length 815
Comment pep:known_by_projection scaffold:Dasnov3.0:JH564669.1:1939128:2415683:1 gene:ENSDNOG00000000580 transcript:ENSDNOT00000000583 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLPALEFSDCCLDSPHFRETLKSHEAELDKTNKFIKELIKDGKSLISALKNLSSAKRKF
ADSLNEFKFQCIGDAETDDEMCIARSLQEFATVLRNLEDERIRMIENASEVLITPLEKFR
KEQIGAAKEAKKKYDKETEKYCGILEKHLNLSSKKKESQLQEADSQVDLVRQHFYEVSLE
YVFKVQEVQERKMFEFVEPLLAFLQGLFTFYHHGYELAKDFGDFKMQLTISIQNTRNRFE
GTRSEVESLMKKMKENPLEHKTISPYTMEGYLYVQEKRHFGTSWVKHYCTYQRDSKQITM
VPFDQKSGGKGGEDESVTLKSCIRRKTDSIEKRFCFDVEAVDRPGVITMQALSEEDRRLW
MEAMDGREPVYNSNKDSQSEGTAQLDSIGFSIIRKCIHAVETRGINEQGLYRIVGVSSRV
QKLLSVLMDPKTASETETDICAEWEIKTITSALKTYLRMLPGPLMMYQFQRSFIKAAKLE
NQESRVSEIHSLVHRLPEKNRQMLQLLMNHLANVANNHKQNLMTVANLGVVFGPTLLRPQ
EETVAAIMDIKFQNIVIEILIENHEKIFNTVPDPPITNAQLHLSRKKSSDSKPPSCSERP
LTLFHAVQSTEKQEQRNSIITSSLESVVSSNANSILNSSSSLQPNMNSSDPDLDVVKPTR
PNSLPPNPSPTSPLSPSWPMFSAPSSPMPTSSTSSDSSPIRSVAGFVWFSVAAVVLSFAW
SSLHAVFSLLVNFVPCHPTLNLLFDRPEEEVHEDSSTPFRKAKALYACKAEHDSELSFTA
GTVFDNVHPSQEPGWLEGTLNGKTGLIPENYVEFL
Download sequence
Identical sequences ENSDNOP00000000445 XP_004452677.1.11602

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]