SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000000615 from Dasypus novemcinctus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000000615
Domain Number 1 Region: 38-208
Classification Level Classification E-value
Superfamily MIR domain 8.37e-57
Family MIR domain 0.00000247
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000000615   Gene: ENSDNOG00000000815   Transcript: ENSDNOT00000000814
Sequence length 224
Comment pep:known_by_projection scaffold:Dasnov3.0:JH569570.1:1033941:1035908:-1 gene:ENSDNOG00000000815 transcript:ENSDNOT00000000814 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWSAGRSRGWAAGPALLGLLLALLVRGGGAAKTGEGLVTCGSVLKLLNTHHRVRLHSHDI
KYGSGSGQQSVTGVEASDDANSYWRIRGDLEGGCPRGSPVRCGQAVRLTHVLTGKNLHTH
HFLSPLSNNQEVSAFGEDGEGDDLDLWTVRCSGQYWERGAAVRFQHVGTSVFLSITGEQY
GSPIRGQHEVHGMPSANTHNTWKAMEGIFIKPGVEPSSAGHDEL
Download sequence
Identical sequences ENSDNOP00000000615 XP_004466491.1.11602

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]