SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000001090 from Dasypus novemcinctus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000001090
Domain Number 1 Region: 96-226
Classification Level Classification E-value
Superfamily TNF-like 8.03e-39
Family TNF-like 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000001090   Gene: ENSDNOG00000001416   Transcript: ENSDNOT00000001416
Sequence length 227
Comment pep:known_by_projection scaffold:Dasnov3.0:JH568133.1:280040:286375:-1 gene:ENSDNOG00000001416 transcript:ENSDNOT00000001416 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XDPYPARGPGAGARPDGGDALSEQSGAPPPSTLVQGPQGKPGRTGKPGPPGPPGDPGPPG
PVGPPGKKGEPGKPGPPGLPGAGGSGAISTATYTTVPRVAFYAGLKNPHEGYEVLKFDDV
VTNLGNNYDAASGKFTCNIPGTYFFTYHVLMRGGDGTSMWADLCKNGQVRASAIAQDADQ
NYDYASNSVILHLDAGDEVFIKLDGGKAHGGNSNKYSTFSGFIIYSD
Download sequence
Identical sequences ENSDNOP00000001090

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]