SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000001442 from Dasypus novemcinctus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000001442
Domain Number 1 Region: 43-134
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 2.06e-39
Family SCAN domain 0.0000517
Further Details:      
 
Domain Number 2 Region: 216-272
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.00000000000157
Family KRAB domain (Kruppel-associated box) 0.0092
Further Details:      
 
Weak hits

Sequence:  ENSDNOP00000001442
Domain Number - Region: 336-378
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00333
Family Classic zinc finger, C2H2 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000001442   Gene: ENSDNOG00000001864   Transcript: ENSDNOT00000001864
Sequence length 390
Comment pep:known_by_projection scaffold:Dasnov3.0:JH567943.1:224457:238300:-1 gene:ENSDNOG00000001864 transcript:ENSDNOT00000001864 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTAESREATGLSPQATQEKDGIVIVKVEEEDEEDHGWGQETPPPDPEIFRQRFRHFCYQN
TFGPREALSRLKELCHQWLRPEVNTKEQILELLVLEQFLSILPKELQVWLQEYRPDSGEE
AVTLLEDLELDLSGQQVPGQVHGPEMLARGMVPLDAGQESSSFELHHEATQSHFKHSSRK
PRLLQTRALPASHVPAPPPEGSPRDQAMASSLFTADSQAMVKIEDMAVSLILEEWGCQNL
ARRNLNRDNRQENYGNVLSQGCENRNENEESSSKAEIAEDSASHGETKGKFQKEFGEKRD
QQGKTVEKQQRNPEEKTGREKRDSVPATIKEKKTTTGERGPREKGKGLGRSFSLSSNFNT
PEEVPTGTKSHRCDECGKCSQGVQALFAIK
Download sequence
Identical sequences ENSDNOP00000001442

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]