SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000001890 from Dasypus novemcinctus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000001890
Domain Number 1 Region: 97-228
Classification Level Classification E-value
Superfamily TNF-like 4.97e-34
Family TNF-like 0.00046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000001890   Gene: ENSDNOG00000002433   Transcript: ENSDNOT00000002432
Sequence length 229
Comment pep:known_by_projection scaffold:Dasnov3.0:JH563690.1:1239723:1243428:1 gene:ENSDNOG00000002433 transcript:ENSDNOT00000002432 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRAPGRGRRGPPLTMPGRLTLPRRRGALRAAGGGSGLGAALALLLLLLPAGWPVRAQNDT
EPIVLEGKCLVVCDSSPSADGAVTSSLGISVRSGSAKVAFSATRSTNHEPSEMSNRTMTI
YFDQVLVNIGNHFDLASSIFVAPRKGIYSFSFHVVKVYNRQTIQVSLMQNGYPVISAFAG
DQDVTREAASNGVLLLMEREDKVHLKLERGNLMGGWKYSTFSGFLVFPL
Download sequence
Identical sequences XP_004450501.1.11602 ENSDNOP00000001890

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]