SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000002018 from Dasypus novemcinctus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000002018
Domain Number 1 Region: 1074-1228
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.55e-50
Family BCR-homology GTPase activation domain (BH-domain) 0.0000565
Further Details:      
 
Domain Number 2 Region: 500-702
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.75e-45
Family DBL homology domain (DH-domain) 0.00047
Further Details:      
 
Domain Number 3 Region: 1-67
Classification Level Classification E-value
Superfamily Bcr-Abl oncoprotein oligomerization domain 2.88e-34
Family Bcr-Abl oncoprotein oligomerization domain 0.000021
Further Details:      
 
Domain Number 4 Region: 716-785,843-877
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000136
Family Pleckstrin-homology domain (PH domain) 0.017
Further Details:      
 
Domain Number 5 Region: 920-1046
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.0000000000000514
Family Synaptotagmin-like (S variant) 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000002018   Gene: ENSDNOG00000002594   Transcript: ENSDNOT00000002597
Sequence length 1284
Comment pep:known_by_projection scaffold:Dasnov3.0:JH569907.1:383385:551739:-1 gene:ENSDNOG00000002594 transcript:ENSDNOT00000002597 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVDPVGFAEAWRAQFPDSEPPRMELRSVGDIEHELERCKASIRRLEQEVNQERFRMIYLQ
TLLAKEKKSYDRQRWGFRRVSQPPDGAAEPRAPAPRPPPAPADAADPLPADEPDARPDGE
GSPGKARPAVARKPGAAAPADREDRGDRGTPTSVAALRSNFERIRKGHGQPGAADTEKPF
YVNVEFHHERGLVKVNDKEVSERISSLGSQAMQMERKKALQGAGLAPGDAPRPPYRGRAS
ESGCGLDGDYEDAELNPRFLKDNLIHANGGGRPPWPPLEYQPYQSIYVGGMMVEGEGKSP
LLRSQSTSEQERRLTWPRRSYSPRSFEDSGGGYTPDCSSNENLTSSEEDFSSGQSSRVSP
SPTTYRLFRDKSRSPSQNSQQSFDSSSPPTPQCPKRHRQGQVVVSEATIVGVRKTGQIWP
SDGDSLSGRVPLDGTCHGDADASFGTLPGGYSCTTDRADEQGRHQDGLPYIDDSPSSSPQ
LGSKGRGGRDALESTKGSELDLEKGLEMRKWVLSGILASEETYLSHLEALLLPMKPLKAA
ATTSQPVLTNQQIETIFFKVPELYEIHKEFYDGLLPRVQQWGHQQRVGDLFQKLASQLGV
YRAFVDNYGVAMETAEKCCQANAQFAEISENLRARSNKDSKEQTTKNSLETLLYKPVDRV
TRSTLVLHDLLKHTPASHPDHPLLQDALRISQNFLSSINEEITPRRQSMTVQKGEHRQLL
KDSFMVELVEGARKLRHVFLFTDLLLCAKLKKQSGGKTQQYDCKWYIPLTDLSFQTLDES
EAAPNIPLVPDEELDALKVKISQIRSDIQREKRANKGSKVIERLKKKLSEQESLLLLTSP
NMAFRVHNRNGKSYTFLISSDYERAEWRENVREQQKKCFKSFSLTSVELQMLTNSCVKLQ
TVHSIPLTINKEDDESSGLYGFLNVIVHSATGFKQSSNLYCTLEVDSFGYFVNKAKTRVY
RDTAEPNWNEEFEIELEGSQTLRILCYEKCYNKTKLTKEDGESTDRLMGKGQVQLDPQVL
HDKDWQRTVIAMNGIEVKLSVKFTSREEKPVCWFESSSQGGLWALTVCPHPRRRERSKVP
YIVRQCVEEIERRGMEEVGIYRVSGVATDIQALKAAFDLNNKDVSVMMNEMDVNAIAGTL
KLYFRELPEPLFTDEFYPSFAEGIALSDPVAKESCMLNLLLSLPEANLLTFLFLVDHLKR
VAEKETVNKMSLHNLATVFGPTLLRPSEKESKLPANPGQPISMTDSWSLEVMSQVQVLLY
FLQLEPSLPRQQSKHLSHESRARI
Download sequence
Identical sequences ENSDNOP00000002018

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]