SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000002362 from Dasypus novemcinctus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000002362
Domain Number 1 Region: 24-152
Classification Level Classification E-value
Superfamily Hormone receptor domain 3.27e-28
Family Hormone receptor domain 0.0017
Further Details:      
 
Weak hits

Sequence:  ENSDNOP00000002362
Domain Number - Region: 105-337
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.0421
Family Rhodopsin-like 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000002362   Gene: ENSDNOG00000003054   Transcript: ENSDNOT00000003054
Sequence length 359
Comment pep:known_by_projection scaffold:Dasnov3.0:JH569388.1:7771:133745:-1 gene:ENSDNOG00000003054 transcript:ENSDNOT00000003054 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGLRTSPLVWGWVVLGSCLLAGAQLDADGTITIEEQIVLVLKAKVQCELNITAQLQEGE
GNCFPEWDGLICWPRGIVGKISAVPCPPYVYDFNHKGVAFRHCNPNGTWDFMHHLNKTWA
NYSECLHLLQPDISLGKQEFFERLYVMYTVGYSISFGSLAVAILTIGYFRRLHCTRNYIH
MHLFVSFMLRAASIFVKDRVVHAHIGAKELQSLLLQDDLQNSIGTLSVDKSQYIGCKIAM
VMFIYFLATNYYWILVEGLYLHSLIFVAFFSDTKYLWGFTLIGWGFPAAFVVAWAVARAT
LADARCWELSAGGIKWIYQAPILAAIGLNFILFLNTVRVLATKIWETNAVGHDTRKQYR
Download sequence
Identical sequences ENSDNOP00000002362

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]