SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000002526 from Dasypus novemcinctus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000002526
Domain Number 1 Region: 104-237
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.83e-34
Family Canonical RBD 0.0000222
Further Details:      
 
Weak hits

Sequence:  ENSDNOP00000002526
Domain Number - Region: 45-96
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.00204
Family beta-sandwich domain of Sec23/24 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000002526   Gene: ENSDNOG00000003267   Transcript: ENSDNOT00000003263
Sequence length 245
Comment pep:novel scaffold:Dasnov3.0:JH579270.1:150473:156821:1 gene:ENSDNOG00000003267 transcript:ENSDNOT00000003263 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDGRIYLLPYLFRVTSCLYLVKIRITKGAEMQSNKTFNLEKQNHTPRKHHQHHHPQHHPQ
QQQQQPPPPPIPANGQQASSQNEGLTIDLKNFRKPGEKTFTQRSRLFVGNLPPDITEEEM
RKLFEKYGKAGEVFIHKDKGFGFIRLETRTLAEIAKVELDNMPLRGKQLRVRFACHSASL
TVRNLPQYVSNELLEEAFSVFGQVERAVVIVDDRGRPSGKGIVEFSGKPAARKALDRCSE
GSFLL
Download sequence
Identical sequences ENSDNOP00000002526

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]