SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000002936 from Dasypus novemcinctus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000002936
Domain Number 1 Region: 214-342
Classification Level Classification E-value
Superfamily PX domain 1.83e-25
Family PX domain 0.0017
Further Details:      
 
Domain Number 2 Region: 5-78
Classification Level Classification E-value
Superfamily SH3-domain 3.94e-16
Family SH3-domain 0.0018
Further Details:      
 
Weak hits

Sequence:  ENSDNOP00000002936
Domain Number - Region: 365-572
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.000977
Family BAR domain 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000002936   Gene: ENSDNOG00000003814   Transcript: ENSDNOT00000003810
Sequence length 574
Comment pep:known_by_projection scaffold:Dasnov3.0:JH572216.1:797445:809862:1 gene:ENSDNOG00000003814 transcript:ENSDNOT00000003810 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALKGRALYDFRSENKEEISIQQDEDLVIFSETSLDGWLQGQNSRGETGLFPASYVEIIR
SGTSSNHANYSSSPAASPGTQVSLYNSPSMSSPARSGGGSGFLSNQGSFEEDDDDDWDDW
DDGCTVVEEPQGGRLGTNGHPPLNLSYPGAYPSQHMPFRPTPPLERQDSLASAKRGSVVG
RNLNRFSCFVRSGVEAFILGDVPMMAKIAETYSIEMGPRGPQWKANPHPFACSVEDPTKQ
TKFKGIKSYISYKLTPSHAGSPVYRRYKHFDWLYNRLLHKFTVISVPHLPEKQATGRFEE
DFIEKRKRRLILWMDHMTSHPVLSQYEGFQHFLSCLDDKQWKMGKRRAEKDEMVGASFLL
TFQIPTEHQDLQDVEDRVDTFKTFSKKMDDSVLQLSTVASELVRKHVGGFRKEFQKLGSA
FQAISHAFQMDPPFSSEALNSAISHTGRTYEAVGEMFAEQPKNDLFQMLDTLSLYQGLLS
NFPDIIHLQKGAFAKVKESQRMSDEGRMAQDEADGIRRRCRVVGFALQAEMNHFHQRREL
DFKHMMQSYLRQQILFYQRVGQQLEKTLRMYDNL
Download sequence
Identical sequences ENSDNOP00000002936 XP_004473555.1.11602

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]