SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000003226 from Dasypus novemcinctus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000003226
Domain Number 1 Region: 3-141
Classification Level Classification E-value
Superfamily UBC-like 1.13e-42
Family UEV domain 0.000000191
Further Details:      
 
Domain Number 2 Region: 324-384
Classification Level Classification E-value
Superfamily Endosomal sorting complex assembly domain 3.86e-21
Family VPS23 C-terminal domain 0.0036
Further Details:      
 
Weak hits

Sequence:  ENSDNOP00000003226
Domain Number - Region: 243-311
Classification Level Classification E-value
Superfamily Tropomyosin 0.00615
Family Tropomyosin 0.012
Further Details:      
 
Domain Number - Region: 152-210
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0123
Family beta-sandwich domain of Sec23/24 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000003226   Gene: ENSDNOG00000004191   Transcript: ENSDNOT00000004188
Sequence length 391
Comment pep:known_by_projection scaffold:Dasnov3.0:JH583624.1:181742:243117:1 gene:ENSDNOG00000004191 transcript:ENSDNOT00000004188 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVSESQLKKMVSKYKYRDLTVRETVNVITLYKDLKPVLDSYVFNDGSSRELMNLTGTIP
VPYRGNTYNIPICLWLLDTYPYNPPICFVKPTSSMTIKTGKHVDANGKIYLPYLHEWKHP
QSDLLGLIQVMIVVFGDEPPVFSRPTISASYPPYPATGPPNTSYMPGMPSGINPYPSGYT
PNPSGYPGCPYPPGGQYPATTSSQYPSQPPVTTVGPTRDGTISEDTIRASLISAVSDKLR
WRMKEEMDRAQAELNALKRTEEDLKKGHQKLEEMVTRLDQEVAEVDKNIELLKKKDEELS
SALEKMENQSENNDIDEVIIPTAPLYKQILNLYAEENAIEDTIFYLGEALRRGVIDLDVF
LKHVRVLSRKQFQLRALMQKARKTAGLSDLY
Download sequence
Identical sequences ENSDNOP00000003226 XP_004484318.1.11602

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]