SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000003417 from Dasypus novemcinctus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000003417
Domain Number 1 Region: 14-267
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 5.23e-46
Family FCH domain 0.0036
Further Details:      
 
Domain Number 2 Region: 440-497
Classification Level Classification E-value
Superfamily SH3-domain 9.58e-24
Family SH3-domain 0.00075
Further Details:      
 
Domain Number 3 Region: 294-367
Classification Level Classification E-value
Superfamily HR1 repeat 0.0000275
Family HR1 repeat 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000003417   Gene: ENSDNOG00000004421   Transcript: ENSDNOT00000004423
Sequence length 505
Comment pep:known_by_projection scaffold:Dasnov3.0:JH583524.1:975512:1045516:1 gene:ENSDNOG00000004421 transcript:ENSDNOT00000004423 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRDPLSDCSYNKVYKNLKEFSQNGENFCKQITSVLQQRANLEISYARGLQKLAIKLSKAL
QSTKKNCVSSAWTWASEGMKSTADLHQKLGKAIQLEAVKPTHQVLSAQEKKRKSLDNQVE
KMANLVISNWNQQIKAKKKLMASTKKHEALFHLIESSKQSVTKKERQKLLNKLEKSAEKL
AKEDENYYQKNIAGYSTRLKWENTLENCYQSILELEKERIQLLCNNLNQYNHQISGFGQT
LTTCHTQVHCAISKIDIEKDIQSLMEETAISSTEKKSEFLLADYFEEEPNTAMDKERRKS
SLKSKLLRLQKDIEKVSRDKEGLDRMLNTYSSSSSFSDAKSQNDTAVLMEETSLKLDLLQ
VNFYKLSSVLAELEQRPKPNHPCNICIFTWKEKEQTHTYVKLSRPFMKKRLENALCKTSR
GQSNPSTSSLASNVVELDNGLCKALYSFQARQDDELNLEKGDIVTVHEKTGEGWWFGSLN
GKKGHFPAAYVEELRSNTENTTSQA
Download sequence
Identical sequences ENSDNOP00000003417 XP_004484257.1.11602

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]