SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000003715 from Dasypus novemcinctus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000003715
Domain Number 1 Region: 142-692,868-1063
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.37e-254
Family Motor proteins 0.00000000203
Further Details:      
 
Domain Number 2 Region: 2139-2327
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.55e-55
Family BCR-homology GTPase activation domain (BH-domain) 0.0000519
Further Details:      
 
Domain Number 3 Region: 16-111
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000000000351
Family Ras-binding domain, RBD 0.01
Further Details:      
 
Domain Number 4 Region: 2073-2132
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.000000000000718
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0057
Further Details:      
 
Domain Number 5 Region: 1071-1163
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000863
Family Phosphoribulokinase/pantothenate kinase 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000003715   Gene: ENSDNOG00000004799   Transcript: ENSDNOT00000004811
Sequence length 2647
Comment pep:known_by_projection scaffold:Dasnov3.0:JH564056.1:1568724:1887177:1 gene:ENSDNOG00000004799 transcript:ENSDNOT00000004811 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNVSDGGRRRFEENELTLHIYPGTISEGTIYCPIPARKNSTAAEVIDSLIHRLHLDKTKC
YVLAEVKEFGGEEWILNPTDCPVQRMMLWPRMALENRLSGEDYRFLLREKNLDGSIHYGS
LQSWLRVTEERRRMMERGFLPQPQQKDFDDLCSLPDLNEKTLLENLRNRFKHEKIYTYVG
SILIAINPFKFLPIYNPKYVKMYDNHQLGKLEPHIYAVADVAYHAMLQHRKNQCIVISGE
SGSGKTQSTNFLIHHLTALSQKGFASGVEQIILGAGPVLEAFGNAKTAHNNNSSRFGKFI
QVNYQETGTVLGAYVEKYLLEKSRLVYQEHNERNYHVFYYLLAGASEEEKLAFHLKQPEE
YHYLNQITKRPHRQSWDDYCCDSELDCFTVEGEDLKHDFERLQLAMEMVGFLPKTRRQIF
SLLSAILHLGNICYKKKTYRDDSIDICNPEILPIVSELLEVKEEMLFEALVTRKTVTVGE
KLILPYKLPEAVTVRNSMAKSLYSALFDWIVFRINHALLNSKDLEQNTKTLSIGVLDIFG
FEDYENNSFEQFCINFANERLQHYFNQHIFKLEQEEYRTEGISWHNIDYIDNTCCINLIS
KKPTGLLHLLDEESNFPQATNQTLLDKFKHQHEENSYIEFPAVMEPAFIIKHYAGKVKYG
VKDFREKNTDHMRPDIVALLRSSKNAFISGMTGIDPVAVFRWAVLRAFFRAAVSFRKAGE
RHVQRKTGHDDTAPCTVLKSMDSFSFLQHPVHQRSLEILQRCKEEKYSITRKNPRTPLSD
LQGMNTLNEKNQHDIFDVAWNSRTGIRQSRLSSSSSLLDKDGIFANSANSKLLERAHGIL
TRNKNLKSKSALPKHLLEVNSLKHLTRLTLQDRITKSLLHLHKKKKPPSISAQFQASLSK
LMETLDQAEPYFVKCIRSNAEKLPLRFNDALVLRQLRYTGMLETVRIRQSGYSCKYLFKD
FVNHFYVLLPRNVIPSKFSIQNFFRKIDLNPDNYQVGKTMVFLKEQERQHLQDLLHQEVL
HRIILLQRWFRVLLCRQHFLHLRQASIIIQRFWRNYLNQKQIRVAAVQKDAFVMASAATL
LQASWRAHLERQRYLELRSAAIIIQQRWREHYRQRYMAAVCIQARWKSYRESKRYQEQRN
KIILLQAIYRGFSARQRFKVLKEQRFKKTKRELGLVNIKAYEALEIQGTDPSEWEDCSFD
NRVKAIEECKSVIESNRISLESSVDYSKESSSKQQERARSQSSMDLQEDVVIRERPKSSE
DLHQKKVGRAKRESRRMRELEQAIFSLELLKVRSLGGVSPSEERRWSTELMPEGIHSFQG
TPDSESSQGSLELLSCEESQKSKQESIILGQGDLQFPSPKSTSSSKFNSQDNVLSASGET
NYVFIQKRAPSDSEHLSNGSMKEKLVCCSKSIICKPQLRDSFISSSLPTFFYIPQQDPLK
TSSQPDTRILRNKLSESEETLGTALTLDVNREGRKYLFPKEDQVVASLDTDSSNTMLKKL
EKLNTDKEERQKQLQQQKEKELMTQIRQQTDILEKERKAFKTIEKPRVGESFIVPSFLQS
EQTLERPSSLLIQNAPNKGEPSVPVSPSIAIKDGALAPKDSPSAHLSLSDQPFTMFFERK
GGPCQSSTIKELAKTGEMGTQLNVAYKHSNNRVSKREHLRPTQPYSHKSDDPSRDKTTGA
IFFTPKDNMNIPPVKKESLNSGNPQLHKQDEPTWKPLKLAGLGQGEVARPAHKKKARMAR
TRSDFLTRGTFADGEGDTEEDDYDDIIEPLLSLDQASHSELGPVPSLGAASHSDSEMTSQ
RFSSIDEQAKLHKTMSQGEITKLVVEQKTSDLDIRPQRAKMRFWAKGKQGEKKTTRVKPA
IQSEVSPLFPGSDVFSSHQFSDELVQYHPTPPLSPELPGSCRKEFKENKEPSPKAKRKRN
VKISSVALESMHWQNDSVQIIASASDLKSMDEFLMKKMNDLDNEDSKKDTLVDVVFKKAL
KEFRQNIFSFYSSALAMDDGKSIRYKDLYALFEQILEKTMRLEQRDWSESPVRVWVNTFK
VFLDEYMNEFKTSDCIATKVPKTERKKRRKKESDLVEEHNGHIFKATQYSIPTYCEYCSS
LIWIMDRASVCKLCKYACHKKCCLKTTGKCSKKYDPELSPRQFGVELSRLTSEDRTVPLV
VEKLINYIEMHGLYTEGIYRKSGSTNKIKELRQGLDRDAESVNLDDYNIHVIASVFKQWL
RDLPNPLMTFELYEEFLRAMGLQERKETIRGVYSVIDQLSRTHLNTLERLIFHLVRIALQ
EDTNRMSANALAIVFAPCILRCPDTTDPLQSVQDISKTTTCVELIVVEQMNKYKARLKDI
SSLEFAENKAKTRLSLIRRSMKPVLIAVRFMSITRSSVSGKGRHRPGNYPSPSSPVVVRL
PSVSDVPEETLTSEAAMETDITEQQQVAMQHEERVLTEQIENLQKEKEELTFEMLVLEPR
ASDDETLESEASIGTADSSENLNIEPEGTISEKSERSLAFSSLKVGGKSEPSSKLRKQLI
KQQDSLDSVDSSISLCLPNTASSHGTRKRFQIYSKSPFYRAASASEALGAEGPLGQTKSL
EDRPQFISRGTFNPEKGKQKLKNVKNSPQKTKETPEGTEVSGHRKTVDADCSSTQQLALL
GNNEFMV
Download sequence
Identical sequences ENSDNOP00000003715 XP_012377855.1.11602

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]