SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000004171 from Dasypus novemcinctus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000004171
Domain Number 1 Region: 11-134
Classification Level Classification E-value
Superfamily EF-hand 2.09e-23
Family Calmodulin-like 0.00032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000004171   Gene: ENSDNOG00000005376   Transcript: ENSDNOT00000005376
Sequence length 136
Comment pep:known_by_projection scaffold:Dasnov3.0:JH564236.1:1149212:1162694:1 gene:ENSDNOG00000005376 transcript:ENSDNOT00000005376 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LTLTGPLPLPPPQVNPFRDRICRVFSHNNVFSFEDVLGMASVFSEQACPSLKIEYAFRIY
DFNENGFIDEEDLQSIVLRLLNSDEEAEDLLEDLAKHVLSESDLDNDNMLSFSEFEHAMA
KSPDFMNAFRIHFWGC
Download sequence
Identical sequences ENSDNOP00000004171

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]