SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000004960 from Dasypus novemcinctus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000004960
Domain Number 1 Region: 257-314
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.07e-25
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 2 Region: 145-202
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.34e-25
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 3 Region: 201-258
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.63e-23
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 
Domain Number 4 Region: 303-355
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.61e-22
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 5 Region: 94-146
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000619
Family Classic zinc finger, C2H2 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000004960   Gene: ENSDNOG00000006405   Transcript: ENSDNOT00000006402
Sequence length 360
Comment pep:novel scaffold:Dasnov3.0:JH569549.1:30715:56874:1 gene:ENSDNOG00000006405 transcript:ENSDNOT00000006402 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEVWKADDQMEKDHGNPDEQTRQFIILKNQTPIEERGNSLGKTFTHSTDFVSLRHVPYKY
DLYEKTLKYNSDLLSSNSYARKKADECNGFEKALLYLKQEKTHTGVEYSEYNKNGKALSH
KEAIFKHQKIRNLVQPFICNYCDKAFSFKSLLISHKRIHTGEKPYECNVCKKTFSHKANL
IKHQRIHTGEKPFECPECGKAFTHQSNLIVHQRAHMEKKPYECSECGKTFAQKFELTTHQ
RIHTGERPYECNECAKTFFKKSNLIIHQKIHTGEKRYECSECGKSFIQNSQLIIHMRTHT
GEKPYECTECGKTFSQRSTLRLHLRIHTGEKPYECSECGKAFSRKSRLSVHQRVHLGDKP
Download sequence
Identical sequences ENSDNOP00000004960 ENSDNOP00000018016 ENSDNOP00000021533

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]