SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000005067 from Dasypus novemcinctus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000005067
Domain Number 1 Region: 48-166
Classification Level Classification E-value
Superfamily Hormone receptor domain 5.36e-32
Family Hormone receptor domain 0.0018
Further Details:      
 
Weak hits

Sequence:  ENSDNOP00000005067
Domain Number - Region: 265-476
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.00394
Family Rhodopsin-like 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000005067   Gene: ENSDNOG00000006541   Transcript: ENSDNOT00000006544
Sequence length 522
Comment pep:known_by_projection scaffold:Dasnov3.0:JH574710.1:684006:753579:1 gene:ENSDNOG00000006541 transcript:ENSDNOT00000006544 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NRRPSSKTKMKLTITSRCFFLFIFLNHPTPILPAPRNHTYPSTIEPEPFLYVLGRKKMID
AQYKCYDRMEQLPPYQGEGPYCNRTWDGWMCWDDTPAGVMTYQYCPDYFPDFDPSEKVTK
YCDEKGVWFKHPENNRTWSNYTMCNAFTPEKLKNAYVLYYLAIVGHSLSIFTLVISLGIF
LFFRSLSCQRITLHKNMFLTYILNSMIIIIHLVEVVPNGELVRRDPNWQIHVFHPNSNVW
AQSWVLVHRHPTLRHTQNIETGASTQVSCKILHFFHQYMMACNYFWMLCEGIYLHTLIVM
AVFTEEQHLRWYYLLGWGFPLVPTTIHAITRALYFNDNCWLSVETHLLYIIHGPVMAALV
VNFFFLLNIVRVLVTKMREDHHPESHMYLKAVRATLILVPLLGIQFVVFPWRPSNKLLGK
IYDYLMHSLIHFQGFFVATIYCFRNNEVQTTVKRQWAQFKTQWNQRWRSRSSNRSTFNAA
MSANDPPVYICHQELRNEAASDKGEEGMEVIALKIIEQESSA
Download sequence
Identical sequences ENSDNOP00000005067

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]