SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000005542 from Dasypus novemcinctus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000005542
Domain Number 1 Region: 1071-1236
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 8.63e-46
Family BCR-homology GTPase activation domain (BH-domain) 0.00028
Further Details:      
 
Domain Number 2 Region: 451-518
Classification Level Classification E-value
Superfamily SAM/Pointed domain 4.24e-31
Family Variant SAM domain 0.0000453
Further Details:      
 
Domain Number 3 Region: 1321-1428
Classification Level Classification E-value
Superfamily Bet v1-like 2.2e-24
Family STAR domain 0.0000212
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000005542   Gene: ENSDNOG00000007161   Transcript: ENSDNOT00000007164
Sequence length 1428
Comment pep:known_by_projection scaffold:Dasnov3.0:JH564670.1:518:397295:-1 gene:ENSDNOG00000007161 transcript:ENSDNOT00000007164 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVAVRKRSWEEHVTQWMGLPLPSADYNTACHHGLGADSVQARMEKDAARNVDRKERCVS
LPDCCHGSELREFLGKPMGGISKEVDGSNSQEGDEQFLSLEASTETLVHVSDEDTDSDLY
LTDEKQVSRTQGCKVSDQSSVIRAGPVAKVQPVVENNQESCKSWGTLETNGERDLLPVEE
RGERRVVGALSKNLELSNDTGLSEINDASKVNACDSLNVKNIVPEKQLLNSAVIAQQRRK
SDFPKDGHERSTFPVVQDEFSATPCVERGLPLSKADFGGCLVQPPSCPGGMSAENGLEKG
DFSEHQNKSLPKVSARDGMQCLHFQETLATQGPADNQVRLRKKKEIREDRDRARLDSMVL
LIMKLDQLDQDIENALSTSSSPSSTPTSLRRHAPDVESGSESGADTISVNQTQINLSSNT
ESTDPPPPSPVGNSGTKPKTVAIPGISEKEKAEIEAKDACDWLRATGFPQYAQLYEDLLF
PIDITLVKREHDFLDRDATEALCRRLNTLNKCAVMKLEISPYRKRSEDSDEDEPCAISGK
WTFQRDSKRWSRLEELDVFSPKQDPVPGSPDEPRLEAAASHESMLSDLSERQDAASVRSL
SSTGSLAGHAPRGGDAAAPPRSPSAASVGPTGHDATSRSPPPPKDPAGSSSGTKGPEKTA
KSRARSLLKRMESLKLKGSHQGRARAPPKLGLLISGPVLQEGLDEQRLKQLNCVEIAALH
GNRINAPPARKRSVSSSTQTSSSSQSDAGSAVSTPSPVARTRSLGACGKRGGMYLEGFDP
FAQCSDVAEHNWRNREGCPEDAVFYIPEDHKPGTFPKALSNGSFPPSGRNASVNWRTGSF
HGPAHLSLRRENGSAGPRELGRRNSSSSASSRLSVYDNVPGSLLYSSSGDLADLENEDIF
PELDDILCHVKGMQRMVNQWSEKLSDEADSDSALDSVSPCPSSPKQIHLEVDNDRATPSD
LDSTGNSLNEPEEPPDIPERRDSGVGASLTRSNRHRLRWHSFQSSHRPSLSSASLQINCQ
SVVQMNLLQKYSLLKLTALLEKYTPSNKHGFSWAVPKFMKRIKVPDYKDRSVFGVPLAVN
VQRTGQPLPQSIQQAMRYLRNHCLDQVGLFRKSGVKSRIQALRQMNESAADGVSYEGQSA
YDVADMLKQYFRDLPEPLMTNKLSETFLQIYQYVPKEQRLPALKAAVMLLPDENREVLQT
LLYFLSDVAAAVRENQMTPTNLAVCLAPSLFHLSTLKRENSSPRVMQRKQSLGKPDQKDL
NENLAATQGLAHMVAECKKLFQVPEEMSRCRNSYTEQELKPLTLEALGRLGKAAPADTQP
FLQHCVDSLCKEAKEKFKGWVNCSTSEQADLSYKKVSEGPPLRLWKATIDVPAGPEEVLN
RLLKEQYLWDVDLLDSKVIEILDSQTEIYQYVQNSMAPHPARDYVVLR
Download sequence
Identical sequences ENSDNOP00000005542

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]