SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000005789 from Dasypus novemcinctus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000005789
Domain Number 1 Region: 741-1031
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.00000000256
Family Rhodopsin-like 0.034
Further Details:      
 
Weak hits

Sequence:  ENSDNOP00000005789
Domain Number - Region: 62-272
Classification Level Classification E-value
Superfamily YVTN repeat-like/Quinoprotein amine dehydrogenase 0.00102
Family YVTN repeat 0.055
Further Details:      
 
Domain Number - Region: 379-423
Classification Level Classification E-value
Superfamily Hormone receptor domain 0.0107
Family Hormone receptor domain 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000005789   Gene: ENSDNOG00000007471   Transcript: ENSDNOT00000007474
Sequence length 1383
Comment pep:known_by_projection scaffold:Dasnov3.0:JH567186.1:4185863:4505563:-1 gene:ENSDNOG00000007471 transcript:ENSDNOT00000007474 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VFLCPGLLKGVYQSEHLFESDHQSGAWCKDPLQASDKIYYMPWTPYRTDTLTEYSSKDDF
IAGRPTTTYKLPHRVDGTGFVVYDGALFFNKERTRNIVKFDLRTRIKSGEAIIANANYHD
TSPYRWGGKSDIDLAVDENGLWVIYATEQNNGKIVISQLNPYTLRIEGTWDTAYDKRSAS
NAFMICGILYVVKSVYEDDDNEATGNKIDYIYNTDQSKDSMVDVPFPNSYQYIAAVDYNP
RDNLLYVWNNYHVVKYSLDFGPLDSRTSTGQAHHGQVSYISPPIHLDSDLERPHVREIST
TGPLGIGSTTTSTTLRTTTWGPARSTTPSGSGRRNRSTSTPSPAVEVLDDITTHVPSASS
QIPALEESCEAVEAREIMWFKTRQGQMAKQPCPAGTIGVSTYLCLAPDGTWDPQGPDLSN
CSSPWVNHITQKLKSGETAANIARELAEQTRNHLNAGDITYSVRAMDQLVGLLDVQLRNL
TPGGKDSAARSLNKVRTTRSNCSRFTEAMVETVNNLLQPQALNAWRDLTTSDQLRAATML
LDTVEESAFVLADNLLKTDIVRENTDNIQLEVARLSTEGNLEDLKFPENMGHGSTIQLSA
NTLKQNGRNGEIRVAFVLYNNLGPYLSTENASMKLGTEAMSTNHSVIVNSPVITAAINKE
FSNKVYLADPVVFTVKHIKQSEENFNPNCSFWSYSKRTMTGYWSTQGCRLLTTNKTHTTC
SCNHLTNFAVLMAHVEVKHGDAVHDLLLDVITWVGILLSLVCLLICIFTFCFFRGLQSDR
NTIHKNLCISLFVAELLFLIGINRTDQPIACAVFAALLHFFFLAAFTWMFLEGVQLYIML
VEVFESEHSRRKYFYLVGYGMPALIVAVSAAVDYRSYGTDKVCWLRLDTYFIWSFIGPAT
LIIMLNVIFLGIALYKMFHHTAILKPESGCLDNINYEDNRPFIKSWVIGAIALLCLLGLT
WAFGLMYINESTVIMAYLFTIFNSLQGMFIFIFHCVLQKKVRKEYGKCLRTHCCSGKSTE
SSIGSGKTSGSRTPGRYSTGSQSRIRRMWNDTVRKQSESSFITGDINSSASLNRGAMANH
LISNALLRPHGTNNPYNTLLGEPAVCNNPSVSMYNAQEGLLNNARDTSVMDTLPLNGNHG
NSYSIASSEYLSNCVQIIDRGYTHNETALEKKILKELTSNYIPSYLNNHDRSSEQNRNLM
NKLVNNLGSGSEDDAIVLDDATSFNHEESLGLELIHEESDAPLLPPRVYSTENHQPHHYT
RRRIPQDHSESFFPLLTNEHTEDLQSPHRDSLYTSMPALAGVPAAESVTTSTQTDPPPAK
SGDAEDVYYKSMPNLGSRNHVHQLHTYYQLGRGSSDGFIVPPNKDGTPPEGSSKGPAHLI
TSL
Download sequence
Identical sequences ENSDNOP00000005789

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]