SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000005855 from Dasypus novemcinctus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000005855
Domain Number 1 Region: 3-124
Classification Level Classification E-value
Superfamily TNF-like 2.49e-36
Family TNF-like 0.000000418
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000005855   Gene: ENSDNOG00000007575   Transcript: ENSDNOT00000007569
Sequence length 125
Comment pep:novel scaffold:Dasnov3.0:JH570428.1:2636914:2640852:-1 gene:ENSDNOG00000007575 transcript:ENSDNOT00000007569 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GAYTFVPWLLSFKRGRALEEKENKILVKETGYFFIYGQVLYTDSTFAMGHLIQRKKVHVF
GDELSLVTLFRCIQNMPETLPNNSCYSAGIAKLEEGDELQLAIPRENAKISQDGDGTFFG
ALKLL
Download sequence
Identical sequences ENSDNOP00000005855

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]