SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000006015 from Dasypus novemcinctus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000006015
Domain Number 1 Region: 1244-1437
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.16e-54
Family BCR-homology GTPase activation domain (BH-domain) 0.0000266
Further Details:      
 
Domain Number 2 Region: 29-44,129-252
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000000000854
Family G proteins 0.0089
Further Details:      
 
Domain Number 3 Region: 427-490
Classification Level Classification E-value
Superfamily FF domain 0.0000051
Family FF domain 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000006015   Gene: ENSDNOG00000007757   Transcript: ENSDNOT00000007758
Sequence length 1500
Comment pep:known_by_projection scaffold:Dasnov3.0:JH578187.1:51913:144851:-1 gene:ENSDNOG00000007757 transcript:ENSDNOT00000007758 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMMARKQDVRIPTYNISVVGLSGTEKEKGQCGIGKSCLCNRFVRPSADEFHLDHTSVLST
SDFGGRVVNNDHFLYWGEVNRSLEDCVECKMHIVEQTEFIDDQTFQPHRSTALQPYIKRA
AATKLASAEKLMYFCTDQLGLEQDFEQKQMPDGKLLIDGFLLGIDVSRGMNRNFDDQLKF
VSNLYNQLAKTKKPIVVVLTKCDEGVERYIRDAHTFALSKKNLQVVETSARSNVNVDLAF
STLVQLIDKSRGKTKIIPYFEALKQQSQQIATAKDKYEWLVSRIVKNHNENWLSISRKMQ
TSPEYQDYVYLEGTQKAKKLFLQHIHRLKHEHIERRRKLYLAALPLAFEALITNLDEIDH
LSCIKAKKLLETKPEFLKWFVVLEETPWDATSHIDNMENERIPFDLMDTVPAEQLYETHL
EKLRNERKRAEMRRAFKENLETSPFITPGKPWEEARSFIMNEDFYQWLEESVYMDIYGKH
QKQIIDKAKEEFQELLLEYSELFYELELDAKPSKEKMGVIQDVLGEEQRFKALQKLQAER
DALILKHIHFVYHPTKETCPSCPACVDAKIEHLVSSRFIRPSDRNQKNSLSDPNIDRINL
VILGKDGLARELANEIRALCTNDDKYVIDGKMYELSLRPIEGNVRLPVNSFQTPTFQPHG
CLCLYNSKESLSYVVESIEKSRESTLGRRDNHLVHLPLTLILVNKRGDTSGETLHSLIQQ
GQQISSKLQCVFLDPASAGIGYGRNINEKQISQVLKGLLDSKRNLNLVGSTASIKDLADV
DLRIVMCLMCGDPFSADDILFPILHSQTCKSSHCGSNNSVLLELPIGLHKKRIELSILSY
HASFSIRKSRLVHGYIVFYSAKRKASLAMLRAFLSEVQDIIPIQLVALTDGAIDVLDNDL
SREQLTEGEEIAQEIDGRFTSIPCSQPQHKLEIFHPFFKDVVEKKNIIEATHMYDNAAEA
CSTTEEVFNSPRAGSPLCNSNLQDSEEDIEPPSYSLFREDTSLPSLSKDCSKLSMELEGN
DGLSFIMSNFESKLNNKVPPPVKPKPPVHFEITKGDLSYLDQGHRDGQRKSVSSSTWLPP
DGFDPSDYAEPMDAVVKPRNEEENIYSVPHDSTQGKIITIRNINKAQSNGSGNGSDSEMD
TSSLERGRKVSIVSKPVLYRTRCTRLGRFASYRTSFSVGSDDELGPIRKKEEDQASQGYK
GDNAVIPYETDEDPRRRNILRSLRRNTKKPKPKPRPSITKTTWESNYFGVPLTTVVTPEK
PIPVFIERCIEYIEATGLSTEGIYRVSGNKSEMESLQRQFDQDHNLDLAEKDFTVNTVAG
AMKSFFSELPDPLVPYSMQIDLVEAHKINDREQKLHALKEVLKKFPKENHEVFKYVISHL
NKVSHNNKVNLMTSENLSICFWPTLMRPDFSTMDALTATRTYQTIIELFIQQCPFFFYNR
PISEPPGATPGSPSAVATTVPFLTSTPVTGQPSPPQSPPPTPQSPMQPLLPSQLQAEHTL
Download sequence
Identical sequences XP_004479121.1.11602 ENSDNOP00000006015

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]