SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000006145 from Dasypus novemcinctus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000006145
Domain Number 1 Region: 268-590
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 9.42e-73
Family p120GAP domain-like 0.0000982
Further Details:      
 
Domain Number 2 Region: 142-252
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.00000000000104
Family Synaptotagmin-like (S variant) 0.066
Further Details:      
 
Domain Number 3 Region: 69-140
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000241
Family Pleckstrin-homology domain (PH domain) 0.028
Further Details:      
 
Weak hits

Sequence:  ENSDNOP00000006145
Domain Number - Region: 932-1046
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0868
Family FCH domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000006145   Gene: ENSDNOG00000007919   Transcript: ENSDNOT00000007921
Sequence length 1104
Comment pep:known_by_projection scaffold:Dasnov3.0:JH577154.1:1762643:1842581:1 gene:ENSDNOG00000007919 transcript:ENSDNOT00000007921 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSSTVATPFYIPGFFSKRLKGSIKRTKSQSKLDRNTSFRLPSLRNTDDRSRGLPKLKESR
SHESLLSPCSAVECLDLGRGEPVSVKPLHSSILGQDFCFEVTYLSGSKCFSCNSASERDK
WMENLRRTVQPNKDNCRRAENVLRLWIIEAKDLAPKKKYFCELCLDDTLFARTTSKTKAD
NIFWGEHFEFYSLPPLHSITVHIYKDVEKKKKKDKNNYVGLVNIPTASVTGRQFVEKWYP
VSTPTPNKGKTGGPSIRIKSRFQTITILPMEQYKEFAEFVTSNYTMLCSVLEPVISVRNK
EELACALVHILQSTGRAKDFLKTTLLSFTFKAAFPGFLIFHHSLLMNENGEKYLKNIKEV
ELIDLIGEFIKALYESDENCEVDPSKCSSSELIDHQSNLKMCCELAFCKIINSYCVFPRE
LKEVFASWKQQCLNRGKQDISERLISASLFLRFLCPAIMSPSLFNLMQEYPDDRTSRTLT
LIAKVIQNLANFAKFGNKEEYMAFMNDFLEHEWGGMKRFLLEISNPETISNTPGFDGYID
LGRELSVLHSLLWEVVSQLDKATVAKLGPLPRVLADITKSLTNPTPIQQQLRRFTEHNSS
PNVSGSLSSGLQKIFEDPTDSDLHKLKSPSQDNTESYFRGKTLLLVQQASSQSMTYSEKD
EKESSLPNGRSISLMDLQDTHAAQVEHTSVMLDVPVRLTGSQLSIAQVASIKQLRETQST
PQSAPQVRRPLHPALNQPGSLQPLSFQNPVYHLNNPIPAMPKASVDSSLENLSTASSRSQ
SNSEDFKLSGPSNSSMEDFTKRSTQSEDFSRRHTVPDRHIPLALPRQNSTGQAQIRKMDQ
AGLGARAKAPPSLPHSASLRSTGSMSVASAALVAEPVQNGSRSRQQSSSSRESPVPKVRA
IQRQQTQKVQSPVDSATMSPVERTAAWVLNNGQYEEDVEETEQNQDEVKHAEKYEQEITK
LKERLRVSSRRLEEYERRLLVQEQQMQKLLLEYKTRLEDSEERLRRQQEEKDSQMKSIIS
RLMAVEEELKKDHAEMQAVIDAKQKIIDAQEKRIVSLDSANTRLMSALTQVKERYSMQVR
NGISPTNPTKLSITENGEFKNSSC
Download sequence
Identical sequences ENSDNOP00000006145

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]